General Information

  • ID:  hor005524
  • Uniprot ID:  Q8K1D8
  • Protein name:  Adropin
  • Gene name:  Enho
  • Organism:  Mus musculus (Mouse)
  • Family:  NA
  • Source:  animal
  • Expression:  In liver, up-regulated in mice fed a high-fat diet for 2 days, and down-regulated in obese mice fed a chronic high fat diet. Also down-regulated in liver 4 hours after treatment with LXR agonist GW3965. |Expressed in liver and brain. Expressed in regions
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005515 protein binding
  • GO BP:  GO:0007165 signal transduction; GO:0045747 positive regulation of Notch signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0005886 plasma membrane

Sequence Information

  • Sequence:  CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP
  • Length:  43
  • Propeptide:  MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP
  • Signal peptide:  MGAAISQGALIAIVCNGLVGFLLLLLWVILCWA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Involved in the regulation of glucose homeostasis and lipid metabolism.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8K1D8-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005524_AF2.pdbhor005524_ESM.pdb

Physical Information

Mass: 525116 Formula: C190H295N55O68S2
Absent amino acids: FIMTW Common amino acids: S
pI: 5.49 Basic residues: 5
Polar residues: 16 Hydrophobic residues: 6
Hydrophobicity: -109.3 Boman Index: -9821
Half-Life: 1.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 38.6
Instability Index: 10866.98 Extinction Coefficient cystines: 1615
Absorbance 280nm: 38.45

Literature

  • PubMed ID:  19041763
  • Title:  Identification of adropin as a secreted factor linking dietary macronutrient intake with energy homeostasis and lipid metabolism.